PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA31G00181
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 375aa    MW: 42725 Da    PI: 6.4341
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA31G00181genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.51.8e-1089129444
                 XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNka 44 
                 +k  rr+++NReAAr+sR+RKka++++Lee   +L +  ++
  AA31G00181  89 DKMKRRLAQNREAARKSRLRKKAYVQQLEESRLKLAQLEQE 129
                 7899*************************965555444444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.003281144IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.2E-886133No hitNo description
PROSITE profilePS502179.34788132IPR004827Basic-leucine zipper domain
PfamPF001704.9E-789130IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.25E-690133No hitNo description
PROSITE patternPS00036093108IPR004827Basic-leucine zipper domain
PfamPF141442.1E-30177251IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042742Biological Processdefense response to bacterium
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MMSSSSPTQL ASLRDVGIYE PFQQIVTWGN AFKSDINNNQ DTSPNTASSS IIQMDARTDD  60
NYKVSYDSSH NVLEHEPSSN DQDEGRIHDK MKRRLAQNRE AARKSRLRKK AYVQQLEESR  120
LKLAQLEQEL EKARQQGLCV RNSSDPSYLG PSGTMNTGIA SFEMEYSHWL EEQNRRVSEI  180
RRAIQAHISD VELRMLVDNC LSHYANLFRM KSEAAKADVF YLISGMWRTS TERFFQWIGG  240
FRPSELLNVV MPYLQPLTDQ QLLEVRNLQQ SSQQAEDALS QGIDKLQQSL AESIGIEVVV  300
ETMDFTAHMA SAVENLQALE GFVNQADHLR QQTLQQMAKI LTTRQAARGL LALGEYLHRL  360
RALSSLWAAR PREPT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00247DAPTransfer from AT1G77920Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010471992.10.0PREDICTED: transcription factor TGA7
SwissprotQ93ZE20.0TGA7_ARATH; Transcription factor TGA7
TrEMBLD7KV550.0D7KV55_ARALL; Predicted protein
STRINGAl_scaffold_0002_24970.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30612766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77920.10.0bZIP family protein